Adipocytes release uridine into the blood during fasting. Which hormone is found in the bloodstream under the same condition as uridine? glucagon, to increase blood glucose levels insulin, to decrease blood glucose levels leptin, to decrease food intake cholecystokinin, to stimulate secretion of digestive enzymes from the pancreas
Q: Starch is an example of a O none of the other answers are correct O fat O carbohydrate O protein…
A: The four classes of biological macromolecules are proteins, nucleic acids, lipids and carbohydrates.…
Q: (a) The pyruvate dehydrogenase complex and the a-ketoglutarate dehydrogenase complex have common…
A: PDH (Pyruvate dehydrogenase) and alpha-ketoglutarate dehydrogenase complexes both contain 3…
Q: . What is the nucleotide sequence of the complementary strand of the DNA molecule:…
A: DNA is the genetic material in most organisms. During transcription RNA Polymerase synthesizes the…
Q: Which of the following types of bonds are not involved in maintaining the tertiary structure of…
A:
Q: Discuss the principles of Thiobarbituric reactive species (BARS) assay
A: Within a cell, reactive oxygen species (ROS) such as singlet oxygen, peroxides etc are produced as a…
Q: Glycolysis is central to carbohydrate metabolism and is an intergrated part of other carbohydrate…
A: Glycolysis is a collection of 10 enzymatically catalysed reactions that sequentially oxidise a…
Q: Problem. The student conducted a chemical experiment to prove the reducing properties of maltose…
A: Chemically carbohydrates are polyhydroxy aldehydes or ketones. They have the general formula :…
Q: Which of the following regarding the Electron Transport Chain is INCORRECT? It can accept electrons…
A: Aerobic metabolism of 1 molecule of glucose can produce 10 NADH (6 from acetyl CoA in TCA cycle + 2…
Q: What is the sequence of the product of transcription of a DNA strand with the following sequence…
A: Since you have posted multiple questions, we will provide the solution only to the first question as…
Q: Name the nucleosides or nucleotides. HOCH2 OH HOCH 2 OH -20 POCH2 OH OH N N NH₂ N N NH₂
A: The nucleotides are phosphoric acid esters of nucleosides, with phosphate at position C-5'. A…
Q: Which nutrient has the highest thermic effect? O Glycogen Fat O Protein Carbohydrate
A: The rise in energy consumption brought on by consuming is known as the thermic effect of food (TEF).…
Q: NA beig sis is a compicated pro cids. Complete the DNA-to-amino acid table for three consecutive…
A: Introduction DNA is a self replicating molecule. mRNA is produced from DNA by a process called…
Q: Which amino acids are exclusively ketogenic? lysine leucine tyrosine isoleucine arginine
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: Using proper convention, provide the amino acid sequence for the following protein. _8_#_H²-8-8° CH3…
A: There are twenty standard amino acids that makeup all the peptides and proteins inside the cell.…
Q: (a) The pyruvate dehydrogenase complex and the a-ketoglutarate dehydrogenase complex have common…
A: Cellular respiration is a collection of three metabolic pathways that generate ATP by oxidation of…
Q: Describe the reaction catalyzed by invertase. To which class of enzymes does invertase belong to?
A: Chemically, carbohydrates are polyhydroxy aldehydes/ketones. They have the general formula :…
Q: In order for a fatty acid stored in an adipocyte to be oxidized by a muscle cell, which of the…
A: INTRODUCTION : Fatty acid oxidation - The oxidation of the fatty acids which are being stored in…
Q: Why doesn't the net reaction for the citric acid cycle have intermediates (citrate, isocitrate,…
A: The acetyl CoA molecules produced through carbohydrate, lipid, and protein metabolism undergo…
Q: How and where are ALT (alanine aminotransferase) and pancreatic amylase produced? What biochemical…
A: Alanine aminotransferase is an enzyme which is also called as serum glutamic pyruvic transaminase.(…
Q: a) What would be the effect on glycogen degradation if a mutation prevents the subunits of protein…
A: After a meal, there is a surplus supply of glucose in the blood. this causes the pancreas to secrete…
Q: Provide the correct three-letter abbreviation for the following amino acid: H3N-CH-C- I CH3
A: The proteins are constituted of twenty naturally occurring amino acid that are connected by peptide…
Q: Use the provided theoretical titration curve of histidine in answering the questions asked. Hd 14 12…
A: Histidine has 3 ionizable groups. The alpha-carboxylic acid group, the alpha-amino groups and the…
Q: Zoey Wong is a research officer at the Department of Biosciences of Tunku Abdul Rahman University…
A: The basic principles of the central dogma of molecular biology is similar in both prokaryotic and…
Q: Draw the structure of a triacylglycerol containing stearic acid, palmitic acid, and oleic acid.
A: Animal fat and vegetable oil fall into the category of simple fats or triglycerides. Triglycerides…
Q: (a) Which antibacterial compound does NOT directly inhibit this process? H₂N NH cycloserine A Ph…
A: The given park nucleotide consist of five amino acids linked by peptide bond with sequence of…
Q: 1. Consider the reaction: succinyl-CoA succinate H3C H3C C H₂ a. What kind of reaction is being…
A: Acetyl CoA produced from fatty acid oxidation in the hepatic cells has two possible fates: enter…
Q: Describe the changes that occur in each step of the mechanism.
A: Enzymes are high molecular weight proteins that catalyse biochemical reactions. Proteases are…
Q: 67. Purified water contains not more than 10 ppm of total solids. Express this concen- tration as a…
A: PPM is an abbreviation for "parts per million" and it also can be expressed as milligrams per liter…
Q: Which of the following is true of the molecule below?
A: DNA/RNA are nucleic acids, the molecules responsible for carrying genetic information from one…
Q: The diagram below describes: A) How the pumping of sodium ions out of the cell can power the…
A: The biological membrane that surrounds a living cell is called the cell membrane. The structure of…
Q: Although insulin initially acts through a tyrosine kinase receptor it also subsequently results in…
A: Receptor tyrosine kinase (RTKs) :- 2nd major type of cell surface receptors. Ligand may be:-…
Q: Which of the following sequences is less favorable to find in a folded beta? Select one:…
A: Two types of secondary structures are abundant in protein: alpha helix and beta sheets. The alpha…
Q: As a result of the rotation about its six bonds, DNA can exist in a variety of forms. Determine…
A: The Watson and Crick double helical DNA explains the B form of DNA. The other forms of DNA are A, C,…
Q: Define optimum pH and temperature of an enzyme. 2. How do changes in pH and temperature affect the…
A: Enzymes are biological catalysts that increases the rate of biochemical reactions. Most enzymes are…
Q: 1. The lactose operon is controlled by both lactose and glucose. Fill in the following table to…
A: The lactose operon is a catabolic operon in Ecoli that encodes proteins that are necessary for the…
Q: 1. Calculate the initial velocity (Vo) of a Michaelis-Menten reaction as a fraction of Vmax when [S]…
A: For a one-substrate enzyme-catalyzed reaction, the Michaelis-Menton equation shows the quantitative…
Q: Phosphorylation is one of the most common mechanisms for regulating the activity of enzymes that…
A: Enzymes constantly switch between activated and deactivated forms, as per the cell's needs. Covalent…
Q: If glucose labeled with 14C in C-3 were metabolized by glycolysis, pyruvate would be labeled in: a.…
A: Glycolysis is the metabolic pathway by which 6 carbon glucose is converted into 3 carbon pyruvate in…
Q: Which type(s) of chromosomal aberrations is/are likely to cause semisterility? Select all correct…
A: Introduction Any change in chromosome number and chromosome structure can cause various genetic…
Q: 4. If the standard reduction potential for NAD+ to NADH is -0.320 V at pH 7 and the standard…
A: Biological oxidation-reduction reactions involve the transfer of electrons from one biomolecule,…
Q: Two proteins bind to the same ligand with the following Kd's. Protein 1: 10 μΜ Protein 2: 100 nM…
A: Consider the following reaction: P + L ⇌k2k1 PL where P is the protein, L is the ligand and k1 and…
Q: (A) Give the polypeptide translation of the RNA sequence below. 5’-AUGGAAAUCAAAGUCAACCUUGAGUUUAGA-3’…
A: As per the central dogma of molecular biology, the genetic information stored in the DNA is copied…
Q: The degradation of CH3 (CH₂ )10 - COOH via the beta-oxidation pathway requires: 6FAD + 6NAD+ +…
A: Fatty acids metabolism involves β-oxidation which happens in the mitochondrial matrix. In…
Q: The sequence of a peptide is given below. YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE If you perform peptide…
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: Norelly. 16-27 How does chitin differ from cellulose in structure and func- tion? Biochemistry Name…
A: Chitin is a polysaccharide-based fibrous substance that is the primary component of the exoskeleton…
Q: Show the chemical equations of the following lipid tests: (1) acrolein test, (2) saponification, (3)…
A: lipids when hydrolyzed with sodium or potassium hydroxide in aqueous or alcoholic environment,…
Q: Which of the following correctly illustrates a dipeptide and an amino acid in the optimal position…
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: Vasopressin is a hormone that plays an important role in social behavior, sexual motivation, and…
A: Recall that: Amino acid sequences are written with N-terminal amino acid on the left and…
Q: The structure shown below iS: H HO CH₂OH -0 H OH H -H OH HOH₂C H 1 0 A) Sucrose 2ÍCH HỌ OB)…
A: The four types of biological macromolecules are nucleic acid, proteins, lipids and carbohydrates.…
Q: The ff: table showed data of enzyme catalytic reaction. The rate of reaction (v) decreased with the…
A: Inhibitor constant (Ki ) is the equilibrium dissociation constant of the Enzyme-Inhibitor complex…
Trending now
This is a popular solution!
Step by step
Solved in 2 steps
- Choose the best answers for each missing word from the list below. (1)________ is a first messenger in the form of gas, and (2)__________ is a metabolite of the amino acid tyrosine that activates glucose export from live cells. The second messenger (3)________ is produced by guanylate cyclase, whereas (4)________ and (5)________ are produced by phospholipase C. 1) nitric oxide, 2) epinephrine, 3) cyclic GMP, 4) diacylglycerol, 5) inositol-1,4,5-trisphosphate 1) nitric oxide, 2) epinephrine, 3) cyclic GMP, 4) diacylglycerol, 5) inositol-3,4,5-trisphosphate 1) ammonium oxide, 2) insulin, 3) cyclic AMP, 4) calcium, 5) inositol- 4,5- trisphosphate 1) oxygen, 2) epinephrine, 3) cyclic GMP, 4) 3-phosphoglycerate, 5) inositol-1,4,5-trisphosphateChoose the best answers for each missing word from the list below. (1)________ is a first messenger in the form of gas, and (2)___________ is a metabolite of the amino acid tyrosine that activates glucose export from liver cells. The second messenger (3)_________ is produced by guanylate cyclase, whereas (4)__________ and (5)_____________ are produced by phospholipase C. 1) nitric oxide, 2) epinephrine, 3) cyclic GMP, 4) diacylglycerol, 5) inositol-3,4,5- trisphosphate 1) nitric oxide, 2) epinephrine, 3) cyclic GMP, 4) diacylglycerol, 5) inositol-1,4,5- trisphosphate 1) nitric oxide, 2) glucagon, 3) cyclic AMP, 4) diacylglycerol, 5) inositol-3,4,5- trisphosphate 1) oxygen, 2) epinephrine, 3) cyclic GMP, 4) 3-phosphoglycerate, 5) inositol- 1,4,5-trisphosphate 1) ammonium oxide, 2) insulin, 3) cyclic AMP, 4) calcium, 5) inositol-4,5- trisphosphateHormones play an important role in the regulation of metabolism. Discuss how insulin will influence the metabolism of the different macromolecules
- Consider fructose-1,6-bisphosphatase (FBP) when responding to Parts A, B, and C. When writing your response, please put A, B, or C in front of the answer for each part. NOTE: Each part can be answered in 3-4 sentences.A. State the effect (inhibition OR activation) of insulin signaling on the activity of FBP. Explain why this effect makes sense and make sure you identify the pathway where FBP participates.B. In a type 2 diabetic liver cell, when the blood sugar level is high, will the activity of FBP be HIGHER, LOWER, or THE SAME AS the activity in a nondiabetic liver cell under the same conditions? Explain your reasoning.C. Now think about the insulin and glucagon signaling pathways that control activity of FBP. When a nondiabetic liver cell is exposed to low blood sugar, indicate one specific way the insulin or glucagon signaling pathway could be disrupted so that the activity of FBP is not controlled correctly. Then, explain the reasoning for your answer.Why can't insulin be given per os? Please explain Please cite/reference the book in which you found the solution.Discuss the chemical cascade caused by ingestion of gluten by someone with coeliac disease.
- Identify if the statements are TRUE or FALSE. If false, write the word/s that make(s) the statement incorrect. In the transamination reaction, the carboxyl group from an amino acid is transferred keto acid. Steroid hormones are derived from cholesterol and are water soluble.From this discussion of the hormonal regulation of glycogen metabolism. Read this material and summarize in no more than one page. Use figures and frame your narrative in terms of the picture. No resources other than the text are required or desirable.DIRECTIONS: The graph below shows the insulin levels between a healthy person and a diabetic after eating a meal. Label the line indicating the normal levels of insulin and the line indicating the insulin levels of a diabetic. Then answer the questions that follow. glucose ingested 250 200 9 150 X 100 50 0 30 90 120 150 180 Time (minutes) 1. Describe how the levels of blood sugar differ in a healthy person, compared to a person with diabetes, after glucose ingestion. 2. Is diabetes an example of homeostasis being disrupted? Explain why. Insulin Level (mIU/L) L 60 O
- The hormones insulin and glucagon are produced, respectively, by Group of answer choices Insulin Glucagon Alpha cells of the pancreas Liver cells Insulin Glucagon Alpha cells of the pancreas Beta cells of the pancreas Insulin Glucagon Beta cells of the pancreas Liver cells Insulin Glucagon Beta cells of the pancreas Alpha cells of the pancreasPlease describe the steps by which insulin would stimulate fatty acid biosynthesis while inhibiting fatty acid oxidation in the liver Enter your answer hereYou eat a sandwich and the components are: bread, cucumber, your choice of meat or non-meat protein (ex: tofu), cheese. Respond to the following questions regarding digestion and energy balance 1. What is the hormone ratio for glucagon and insulin after eating the sandwich. Create a graph of how blood glucose levels change within 20 minutes of eating the sandwich. . 2. What state(s) is your body in (circle one for each pair): post absorptive/absorptive, catabolic/anabolic, fasted/fed 3. Create a chart/drawing showing where digestion takes place for each component (bread/veggies, cheese, protein choice). • location • phase • absorbable unit one hormone/secretion/enzyme that aids in the process what organs contribute and if they are exocrine or endocrine cells participating