In beta-oxidation, which cofactor is required the for second oxidation reaction (conversion of beta-hydroxyacyl-CoA to beta-ketoacyl-CoA)? NAD+ water FAD CoA-SH
Q: Which of the following, found within the interior of cytosolic proteins, is the most dominant…
A: Introduction Protein is the most abundant macromolecule of our body. Protein performs many functions…
Q: What term best describes the isomeric relationship between alpha-D- glucopyranose and…
A: Introduction Carbohydrate is one of the biomolecules in our body. It is made up of carbon, hydrogen…
Q: 5. Gout can be caused by superactivation of PRPP synthase, or partial deficiency of…
A: Gout is a metabolic disorder, which is caused due to the accumulation salts of uric acid in the…
Q: Which option best describes the following figure? Y (fraction saturation) 1.0 0.8 0.6 0.4 0.2 0.0 0…
A: Hemoglobin and myoglobin are heme group proteins that can bind to oxygen. While hemoglobin is found…
Q: Draw the structure of a triacylglycerol containing stearic acid, palmitic acid, and oleic acid.
A: Animal fat and vegetable oil fall into the category of simple fats or triglycerides. Triglycerides…
Q: hat is a balanced gamete? A).A gamete that does not contain any chromosomes with inversions B.)A…
A: Introduction Gametes are produced by meiosis before fertilization. Gametes contain half of the total…
Q: Steps of the pathway Adenylate cyclase and Tyrosine Kinase System
A: Receptors are proteins that bind to specific ligand molecules and trigger a signaling pathway.…
Q: it is widely accepted that proteins can organize themselves according to a range of stable…
A: Introduction Proteins are the most abundant macromolecules in our body. proteins are made up of…
Q: A first year BS Nursing was given an unknown carbohydrate that could be any of the following:…
A: Iodine test is a qualitative test for carbohydrates. In the iodine test, the polyiodide ions react…
Q: How do R groups constrain the potential conformations of a protein?
A: As per the central dogma of molecular biology, DNA contains the code that is necessary for the…
Q: 1 is there a positive or negative entropy change in the first step of histidine synthesis? 2 how…
A: "Since you have asked multiple questions, we will solve the first three questions for you. If you…
Q: 14. Which of the following is a secondary amide? A. 요 B. NH₂ C. D.
A: Ans: INTRODUCTION The amide group is represented in structural formula by CONH2 .…
Q: Zoey Wong is a research officer at the Department of Biosciences of Tunku Abdul Rahman University…
A: The basic principles of the central dogma of molecular biology is similar in both prokaryotic and…
Q: Question 14 The first three amino acids in a protein are lysine, glutamine, and serine. T describes…
A: The four classes of biological macromolecules are proteins, nucleic acids, carbohydrates and lipids.…
Q: Amino Acid Derivatives Q7.3: What explains the observation that individuals with phenylketonuria…
A: Phenylketonuria is an inborn error of metabolism. This disease is caused by mutations in the gene…
Q: a) What would be the effect on glycogen degradation if a mutation prevents the subunits of protein…
A: After a meal, there is a surplus supply of glucose in the blood. this causes the pancreas to secrete…
Q: Why is cholesterol an important steroid?
A: Steroids are the compounds that consist of three cyclohexane rings and a cyclo pentane ring in…
Q: The structure of purine is shown. 2 N-1 N-3 N-7 N-9 6 5 N 4 3 7 N -N9 ZI 8 Which atoms of the purine…
A: Purines: The two groups of nitrogenous bases, which also include the two groups of nucleotide…
Q: ys (or drag). o paste
A: .
Q: 1. Minor changes in primary structure can have pronounced effects on biological function. Tetrameric…
A: Hemoglobin is a tertameric protein made up of 4 subunits namely α2β2. The αβ form a dimer and 2 such…
Q: a) What is the overall function of pyruvate carboxylase? b) Describe the role of each of the four…
A: (a) A metabolic enzyme called pyruvate carboxylase takes part in the first stage of gluconeogenesis.…
Q: Enzymes are important molecules in biochemistry that catalyze reactions. The energy diagram…
A: Since there are multiple questions and which question is to be solved has not been specified, as per…
Q: How many ATP will be yielded in 2 moles of an 17:0 and 18:0 carbon chain?
A: Beta oxidation is a process of oxidation of fatty acids into acetyl CoA. The total amount of ATP…
Q: Look at this molecule and determine the number of molecules created from B-Oxidation: FADH2, NADH +…
A: Beta-oxidation is the process of degradation of fatty acids, in order to synthesize energy during…
Q: A sample of yeast extract has been analyzed of its invertase activity. The effect of temperature on…
A: Invertase is the enzyme that catalyze the hydrolysis of sucrose in fructose and glucose. Sucrose is…
Q: Transfer to PRPP Please show mechanism steps and arrow pushing.
A: Nucleophiles are electron donating groups . They participate in biochemical reactions by donating a…
Q: Give a CHEMICAL test that can differentiate the pair of sugars and give the results for both. No…
A: Introduction: Carbohydrate is an important source of energy that is important for all living…
Q: The primary structure of a protein describes Number of peptide linkages Sequence of the amino acid…
A: The protein structure is divided into four types. They are primary structure, secondary structure,…
Q: A competitive inhibitor diminishes the rate of catalysis: A) By reducing the proportion of enzyme…
A: The enzymes are biological catalysts that increases the rate of biological reactions. The enzymatic…
Q: G Protein-Coupled Receptor (GPCR) Signaling Q.7.3: Glucagon and epinephrine both signal stress,…
A: Glucagon is a peptide hormone secreted from the alpha cells of the pancreatic islets of Langerhans.…
Q: Consider the following peptide: Lys-Tyr-Glu-His-Arg-Ala-Asp-Arg-Glu-Tyr-Lys a) What is the net…
A: The proteins are constituted of twenty naturally occurring amino acids that are connected via…
Q: n a table, write down the enzyme that acts on proteins and also mention the final product of…
A: Introduction: Enzymes are proteins that act as biological catalysts to fasten the rate of the…
Q: The figure below shows the titration curve for the amino acid aspartic acid. There are five key…
A: Amino acids are the main units of protein. Each amino acid has a central carbon atom called Cα. To…
Q: What is the sequence of the mRNA molecule synthesized from the DNA template strand…
A: The genetic information stored in DNA is copied to an mRNA through a process known as transcription.…
Q: Think of an additional application of the Disk diffusion method based on your experience and…
A: Disk diffusion method is a culture based microbiological assay technique in which bacteria is grown…
Q: 67. Purified water contains not more than 10 ppm of total solids. Express this concen- tration as a…
A: PPM is an abbreviation for "parts per million" and it also can be expressed as milligrams per liter…
Q: From a kinetics experiment, Kcat was determined to be 55sec^-1. For the kinetic assay, 0.05mL of a…
A: The concentration of enzyme stock solution was 0.05mg/ml. i.e. 1ml contain 0.05mg of enzyme. We took…
Q: The sequence of a peptide is given below. YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE If you perform peptide…
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: C.Why does 500 mM imidazole result in the elution of a protein with a 6X-His tag?
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: what experiment can be used to confirm that agglutination was due to the binding of the lectins to…
A: Lectin is the collective name for all sugar-binding proteins. Lectins have one or more than one…
Q: Please explain why hydrolysis of ATP can release much energy by describing how the products of ATP…
A: ATP hydrolysis is the catabolic reaction process in which chemical energy that is stored in the…
Q: Although insulin initially acts through a tyrosine kinase receptor it also subsequently results in…
A: Receptor tyrosine kinase (RTKs) :- 2nd major type of cell surface receptors. Ligand may be:-…
Q: A Class Il aminoacyl-tRNA synthetase installs the formyl-methionine on tRNAMet in bacteria. A…
A: As per the central dogma of molecular biology, genetic information is stored in the DNA. The genetic…
Q: Fructose 1,6-bisphosphatase (FBPase) is a key enzyme in gluconeogenesis. The mammalian enzyme is…
A: Gluconeogenesis is a process in which glucose is synthesize from non-carbohydrate sources like…
Q: Calculate the appropriate volume (in µL) of 9X loading buffer that should be added to 46.0 µL of a…
A: Agarose gel electrophoresis is a laboratory technique that is used for the separation of nucleic…
Q: 4. You are to choose the members of an expedition that will climb several high mountains. Each…
A: Note: Hi! Thank you for the question. We are authorized to answer one question at a time. Since you…
Q: How can RNA sequencing (RNA-Seq) and Mirccorays in Transcriptome analysis find disease genes? Please…
A: Researchers can describe the transcriptional activity (coding and non-coding), concentrate on a…
Q: 2. Enzymes A) have highest affinity for the substrate B) have highest affinity for the product C)…
A: In the enzyme active site is the region of the enzyme where the substrate binds and catalysis…
Q: Give the systematic name for the disaccharide shown in the image by selecting the appropriate terms.…
A: Conformation is the different positions a molecule can twist into. Configuration is the arrangement…
Q: Can you write possible mineralization and biotransformation reactions for glucose (C6H12O6) ?
A: Biotransformation is the biochemical process (metabolism) taking place in some life form that alters…
Step by step
Solved in 2 steps
- Complete oxidation of a 16-carbon fatty acid can yield 129 molecules of ATP Study Figure 19.2 and determine how many ATP molecules would be generated if a 16-carbon fatly acid were metabolized solely by the TCA cycle, in the form of S acetyl-CoA molecules.Study Figure 19.18 and decide which of the following statements is false. Pyruvate dehydrogenase is inhibited by· NIADH. Pyruvate dehydrogenase is inhibited by AΤΡ. Citrate synthase is inhibited by NADH. Succinyl-CoA activates citrate synthase. Acetyl-CoA activates pyruvate carboxylase.C-CH2 + H* CO, + CH,-C-S-COA S-COA Malonyl-CoA Acetyl-CoA Hydrolase Transferase Lyase Ligase
- Which enzyme is used for both the synthesis and breakdown of acetoacetate? thiolase O HMG-CoA synthase OB-hydroxybutyrate dehydrogenase O B-Ketoacyl-CoA transferaseWhat is the rate-limiting step in the synthesis of acetyl CoA? oxidation regeneration of lipoamide decarboxylation transfer to lipoamide transfer to CoAHow many more acetyl CoA are generated from stearic acid than from linoleic acid during beta oxidation?
- Below is an image of the Krebs cycle: acetyl-CoA oxaloacetate COASH H20 NADH NAD* H20 malate citrate fumarate isocitrate FADH2 NAD* CO2 FAD АТР NADH + ADP succinate GTP NAD+ a-ketoglutarate H20 GDP NADH + CO2 COASH succinyl CoA COASH Consider the conversion of succinate to fumarate, which is coupled with the production the electron carrier FADH2. If this reaction was NOT coupled with the production of FADH2 (and only catalyzed the conversion of succinate to fumarate), how would this impact ATP production through cell respiration? OATP production would stop because no high energy electron carriers would be produced ATP production would still occur, but there would be a much lower ATP yield because a large number of electron carriers are no longer being made ATP production would stop because without FADH2 we will no longer have electrons moving through the electron transport chain ATP production would still occur, but there would be a slightly lower ATP yield because a small number of…Fatty acids are activated for breakdown through the action of acyl-CoA synthestase. Which of the following statements regarding acyl-CoA synthetase is not true? ● It catalyzes the addition of CoA to the fatty acid One of the products of the reaction is ADP. O The free energy change for the reaction catalyzed by this reaction is close to 0 kJ/mol, but the subsequent hydrolysis of pyrophosphate drives the reaction forward. O The reaction results in the formation of a thioester bond.The large amount of energy used during aerobic exercise(e.g., running) requires large amounts of oxaloacetate.Explain why acetyl-CoA cannot be used to produceoxaloacetate in this circumstance. What is the sourceof oxaloacetate molecules during aerobic activity?
- The enzyme is considered to be alan * ÇOO ÇOO Lactate dehydrogenase HO-C-H+ NAD C=0 + NADH + H CH: Pyruvate Lactate O Oxydoreductase O Isomerase O Hydrolase O Ligase O DehydrataseHow many moles of ATP are synthesized by adding stearate to TCA through B-oxidation? Why is that? Briefly explain.Before β-oxidation, fatty acids must be converted to their CoASH derivatives. Explain why this reaction is necessary.