In the presence of oxygen, most living cells make ATP by oxidative phosphorylation, which takes place in the mitochondria. One of the major substrates that is oxidized is NADH. The overall reaction for this process is given by the equation below. NADH + H+ ¹2 O2 →→→ NAD+ + H₂O
Q: The active form of insulin contains No disulfide bonds Intra-chain disulfide bonds Inter-chain…
A: Insulin is a peptide hormone secreted by beta cells of pancreatic islets of Langerhans that…
Q: In detail ,compare between alpha helices and beta sheets?
A: Proteins are the biomolecules that show great variation in their structural organisation. They are…
Q: An unspecified protein contains a 15-residue long α-helix with the following sequence:…
A: given that, an unspecified protein contains a 15 residue long alpha helix.(a)we know that, alpha…
Q: Which solution conditions would be best used for eluting a transcription factor from a DNA affinity…
A: We need to identify the solution conditions used for eluting a transcription factor from a DNA…
Q: What is the hydrogen bonding pattern within an alpha helix? a. Lone pair on C=O of residue i to…
A: We have to determine the hydrogen bonding pattern within an alpha helix
Q: Questions 1) Determine the single letter code 40 amino acid sequence of the venom peptide by…
A: Chymotrypsin (endopeptidase) hydrolyzes peptide bonds on the C-terminus of a peptide bond of an…
Q: Decide whether each of the following statements is true about chitin deacetylase. It tremendously…
A: Chitin deacetylase is an enzyme found in a wide range of microorganisms, including fungi and…
Q: 1Need help:. draw valine-aminoacyl tRNA synthetase. Show the tRNAs and the valine amino acid. You…
A: A transfer RNA (tRNA) is a unique type of RNA molecule with the essential function of facilitating…
Q: Consider a protein in which a negatively charged glutamic acid side chain (pKa = 4.2) makes a salt…
A: Salt bridges are attractive interactions between two oppositely charged groups. So, more oppositely…
Q: An intermediate folding stage seen in protein denaturation or renaturation is called : a) domain b)…
A: An intermediate folding stage seen in protein denaturation or renaturation is called :and option :a)…
Q: The major secondary structure seen in collagen is: a) alpha helix b) beta sheet c) collagen…
A: We provide the answer to the first question. Please repost your question separately for remaining…
Q: Illustrate the ATP hydrolysis reaction, its regeneration and the AG for both reactions. Show where…
A: ATP is the energy currency of the cell. It is simply an adenosine molecule bonded to a triphosphate.…
Q: Please draw the structure of the amino acid Histidine at each ionization state and please also give…
A: a) Histidine has three ionizable groups and equilibrium equations for its three ionizations are…
Q: Classify each of the following fatty acids as saturated, monounsaturated, or polyunsaturated.…
A: • Saturated fatty acids: saturated fatty acids are fatty acids that contain only single covalent…
Q: R is the highly active form of the enzyme and T is the less active form of the enzyme. Assume that…
A: Positively cooperative enzymes demonstrate regulatory behavior in which binding a substrate molecule…
Q: 0 0 One strand is parallel and another is anti-parallel Parallel R Not enough information…
A: Beta sheet structure is a type of secondary structure of a protein. It has a more extended…
Q: Question 23 Imagine that for the reaction AB the equilibrium constant is 16, and that for the…
A: To determine ΔG for the reaction A ⇌ C, we can utilize the equilibrium constants (K) and the Gibbs…
Q: Name two (2) elements which fit each of these descriptions Found in biological macromolecules Found…
A: Trace elements (or trace metals) are minerals present in living tissues in small amounts. The trace…
Q: All of the following statements about amino acid metabolism in humans are true except: The process…
A: The complex series of metabolic processes in the body that involve the synthesis and breakdown of…
Q: Many biochemists go bananas, and justifiably, when they see a Michaelis-Menten plot like the one…
A: For a one-substrate enzyme catalyzed reaction, the Michaelis-Menton equation shows the quantitative…
Q: A mutation occurs that changes a codon from UCC to UCA. It turns out that this codon is for an amino…
A: Based on the nature of change that occurs in a codon due to a point mutation (mutation at a single…
Q: Decide whether each of the following statements is true about leucine transaminase. It's an enzyme,…
A: Leucine transaminase indeed functions as an enzyme within biochemical processes. It serves as a…
Q: The figure shown here is a Ramachandran plot. The plausible secondary structure that can be found in…
A: The Ramachandran plot is used to depict the statistical distribution of the combinations of the two…
Q: 4. The molecular structure of the last 12 amino acid residues (dodecapeptide) that comprise the C-…
A: A peptide is a short chain of amino acid residues linked together via a peptide bond. Amino acid…
Q: You have an initial solution in which you added quantities of “A” and “B” such that there is 4.5 M…
A: Since conditions inside the cell are different than standard temperature and pressure, biochemists…
Q: Which graph would you use to graphically determine Rmax and KM? O 150 O Rmax = R (µmol · L-1• min−¹)…
A: Km is the catalytic constant which is equal to the substrate concentration at half of maximum…
Q: Arachidonic acid (mm) 0.295 0.354 0.531 0.885 2.07 Vmax = Km Rate of formation of PGG2 (mM/min) =…
A: Kinetic parametersFor a one-substrate enzyme-catalyzed reaction, the Michaelis-Menten equation…
Q: The amino acid sequence of a small protein is MSRLASKNLIRSDHAGGLLQATYSAVSSIKNTMSFGAWSNAALNDSRDA.…
A: MHC (Major Histocompatibility Complex) are molecules responsible for presenting pathogenic peptides…
Q: Consider the second titration. PH 14.0 12.0 10.0 8.0 10 11 7 4 1 9 6.0 4.0 2.0 0.0 0.5 1.0 1.5 2.0…
A: Titration is used for determining the amount of acid in a solution. Sodium hydroxide is added to a…
Q: Triacylglycerols are Ketones Esters Aldehydes Ether
A: Triacylglycerols, also known as triglycerides, are a type of lipid molecule commonly found in fats…
Q: Carbon dioxide is dissolved in blood (pH 7.5) to form a mixture of carbonic acid and bicarbonate.…
A: pH=pKa+log( A−/HA) Given the pKa valuespH=6.3+log(HCO3−/H2CO3)Since we're neglecting free CO2, we'll…
Q: Determine whether each of the examples or phrases describes an essential amino acid, a nonessential…
A: Amino acids are the monomer units of proteins. Out of the 20 general proteogenic amino acids, some…
Q: Hydrogen bonds are noncovalent interactions between a hydrogen atom with a partial positive charge,…
A: Every hydrogen bond is composed of a hydrogen bond donor and a hydrogen bond acceptor.The hydrogen…
Q: Match the descriptions and compounds with the terms competitive, uncompetitive, and noncompetitive…
A: Enzymes are biological catalysts that increase the rate of biochemical reactions.Most enzymes are…
Q: Determine the value of the turnover number of the enzyme invertase, given that Rmax (Vmax) for…
A: Details
Q: Step 6 of the citric acid cycle is shown. Which statement best describes the role of FAD in this…
A: Citric acid cycle is a metabolic pathway that regenerates oxaloacetate from citrate. Acetyl CoA from…
Q: In this chapter, we described co-immunoprecipitation as a method for identifying binding partners to…
A: Co-immunoprecipitation (Co-IP) is a laboratory technique used to identify and characterize…
Q: The hexokinase can be inhibited by a non competitive inhibitor. On your enzyme show where the non…
A: Hexokinase catalyzes the reaction of glucose binding to ATP to form glucose 6 phosphate. The…
Q: A mutation of Lysine 82 (in the DPG-binding pocket) to Arginine in beta sub-unit will most likely…
A: Changing the genetic code of a living thing permanently and inherited is known as a mutation. The…
Q: An Fab fragment binds to lysozyme with a dissociation constant of K4 = 10 M. A 1 nM (10 M) solution…
A: Consider the following reaction: where P is the protein, L is the ligand and k1 and k2 are rate…
Q: | a) Match the type of bond with the role below: Bond_type (a) phosphodiester (b) N-glycosidic (c)…
A: Nucleic acids are one of the 4 biomacromolecules. Nucleic acids are generally found in 2 forms in…
Q: CH3 нно │ │ | wwN-C-C-N-C-C-N-C-Cmw H | | I нно serine leucine alanine Determine which amino acids…
A: Peptides are polymers of amino acids. Amino acids are simply an alpha-carbon bonded to 4 different…
Q: Sequential reaction releases one or more products before all substrates bind the enzyme Answer Bank…
A: In a sequential enzyme catalyzed reactions all substrates bind in a kind of sequential order to its…
Q: An enzyme that follows simple Michaelis-Menten kinetics has an initial reaction velocity of 10 µmol…
A: Initial velocity of the reaction,V= 10 mol.min-1The substrate concentration, [S] is 5 times greater…
Q: 1. (a) By binding one L-tryptophan molecule/monomer, the trp repressor binds to DNA to sup- press…
A: An atom's or molecule's electrostatic charge, which can be either positive or negative depending on…
Q: How many peptide bonds are present in the peptide shown below?
A: By removing a water molecule from an amino group of one amino acid and a carboxyl group of the…
Q: a. What is the classification of the Arabinose in terms of combined no. of carbons and highest…
A: The five-carbon sugar arabinose is extensively distributed in nature and can be the only carbon…
Q: The amino acid arginine ionizes according to the following scheme: ▼ Part A pl = Diff Submit NH₂ C=N…
A: Iso electric point is defined as the pH at which the amino acid carries no net charge and exists in…
Q: What are the roles of sodium dodecyl sulfate (SDS) in two-dimensional electrophoresis? to cause…
A: Two-dimensional gel electrophoresis (2-DE) is an important technique in proteomics work.It is used…
Q: Draw a diagram of the hydrogen bonding interactions in a right-handed alpha helix (show all main…
A: There are four classes of biological macromolecules: proteins, nucleic acid, carbohydrates and…
Need help, please.
Step by step
Solved in 3 steps with 3 images
- Refer to the figure shown here, and determine the value of E for the overall oxidation/reduction reaction (refer to the book/lecture slides if you need help with the overall reaction). 121/202 + 2H+ + 2e → H₂0 NAD + H* + 2e → NADH O-1.136 volts O 0.496 volts O+1.136 volts voltsm -0.496 volts EU (volts) +0.816 - 0.320When grown anaerobically on glucose, yeast (S. cerevisiae) converts pyruvate to acetaldehyde, then reduces acetaldehyde to Pethanol using electrons from NADH. Write the chemical equation for the reaction that reduces acetaldehyde (CH3CHO) to ethanol (CH3CH2OH). The table provides the standard reduction potential, E', of the relevant half-reactions. Half-reaction Acetaldehyde + 2 H+ + 2e¯ → ethanol NAD+ + 2H+ + 2e¯ → NADH + H+ E'° (V) -.197 -.320 Calculate the equilibrium constant, K'eq, at 25.0 °C for the reaction that reduces acetaldehyde to ethanol. K'e ×10 = eqIndicate whether each of the following changes represents oxidation or reduction. Write: O = for oxidation ; R= for reduction Example: cyt ci (Fet) → cyt c1 (Fe2+) Answer: R Blank #1: COQH2 → CoQ Blank #2: NAD+ - NADH Blank #3: FMN → FMNH2 Blank # 4: FADH2 FAD Blank #5: Fe(III) SP → Fe(II) SP Blank # 1 Blank # 2
- Consider the reaction: malate + NAD+ → oxaloacetate + NADH + H+. Calculate ΔE°’ for the reaction.Balance the following net reaction that occurs during oxidative phosphorylation. Use the smallest whole integers possible for the reaction stoichiometry. NADH+ FADH₂ + ADP+ 0₂+H+PO, ¹ NAD+FAD+ ATP+ +H₂OThe enzyme glutamine synthetase catalyzes the following reaction: glutamate + ATP + NH3 → glutamine + ADP + phosphate Which of the following statements about this reaction is correct? a. The reaction is endergonic whether or not enzyme is added b. The reaction is only endergonic if enzyme is added c. The reaction is only exergonic if enzyme is added d. The rate of oxygen production will be unaffected e. The reaction is exergonic whether or not enzyme is added
- Decylic acid is a saturated fatty acid that occurs naturally in coconut oil and palm kernel oil. Calculate the net ATP yield when decylic acid undergoes complete B oxidation. The formula of decylic acid is shown below: (Given: The oxidation of one NADH yields 2.5 ATP; the oxidation of one FADH2 yields 1.5 ATP; and the oxidation of one acetyl CoA yields 10 ATP.) O 50 ATP O 52 ATP 66 ATP OH O 64 ATPIn the energy recovery phase of glycolysis, Glyceraldehyde 3-p reacts with NAD+ In this reaction, which will be oxidized, and which will be reduced. In simple terms, what does it mean when a chemical is oxidized, and what does it mean when a chemical is reduced?Starting with glucose, there are five steps in the EMP/TCA metabolic pathways that produce NADH (which is converted to ATP or energy). Use class notes, Shuler, Kargi and DeLisa book, or the internet. 1. A. Draw the chemical structures of the reactant(s) and product(s); as well as a balanced chemical reaction for the step in the TCA (Krebs) cycle where isocitrate is converted to a-ketoglutarate (step 3 in the class notes). (You don't need to draw the structures of coenzyme A (COA), NAD* or NADH.) B. What enzymes catalyze steps 3 and 5 in the Kreb's cycle from the class notes? C. Would you categorize step 8 in the TCA cycle where malate is converted to oxaloacetate as an oxidation or reduction of malate? D. Considering that some energy is spent transporting acetyl-CoA to mitochondria, how much net energy (in kcal) is produced by converting 15 mol of glucose to CO₂ in the glycolysis & Krebs cycle pathways? E. How many kcals of energy from oxidizing 15 mol of glucose to CO₂ (your answer to…
- What terms would best describe the above coupled reaction? (If the DGo for ATP hydrolysis into ADP + inorganic phosphate is -7.3 kcal/mole, and the DGo for maltose synthesis from glucose + glucose is +3.7 kcal/mole, calculate the standard free energy change for the combined reaction of ATP + glucose + glucose g ADP + maltose + inorganic phosphate.) it is non-spontaneous and endothermic (because the overall DGo is negative) it is spontaneous and exothermic (because the overall DGo is negative) it is non-spontaneous and endothermic (because the overall DGo is positive) it is spontaneous and exothermic (because the overall DGo is positive) it is non-spontaneous and exothermic (because the overall DGo is negative)(a) Consider the oxidation of malate to oxaloacetate by NAD*: malate + NAD+ → oxaloacetate + NADH + H+ In yeast mitochondria, where the pH = 8.1, this reaction is exergonic only at low oxaloacetate concentrations. Assuming a pH = 8.1, a temperature of 37 °C, and the steady-state concentrations given below, calculate the maximum concentration of oxaloacetate at which the reaction will still be exergonic. malate + NAD*→ oxaloacetate + NADH + H* lactate + NAD →→ pyruvate + NADH + H+ half reaction Pyruvate + 2H+ + 2e → lactate Pyruvate + CO₂ + H + 2e → malate Intracellular steady state concentrations: malate = 410 μM; NAD = 20.0 mM; pyruvate = 3.22 mM; NADH = 290 μM; AG=+29.7 kJ/mol AG¹ = +25.1 kJ/mol E° (V) - 0.190 - 0.330 lactate 1.1 mM CO₂ = 15.5 torrUnder standard conditions, will the following reactions proceed spontaneously as written? (1) Fumarate + NADH + H+ (2) succinate + NAD+ Cyto a (Fe²+) + cyto b (Fe³+) = cyto a (Fe³+) + cyto 6 (Fe²+) b