Using the following sequence and the amino acid chart, please give the amino acid sequence: 5'-UCAGAUGGGAAGCUUGAUCUUGUGA-3'. Abreviations for the amino acids are accepted.
Q: Livestock Breed Identific - Student Notes 46. Piedmontese Size: breed Cows average between 1.200 to…
A: The Piedmontese is a breed of domestic cattle, originated in north west Italy in the region of…
Q: To explain: Why professional gardeners soak their seeds in hydrogen peroxide before planting.
A: Seeds inside each fruit are designed to germinate and grow into a new plant on their own, a process…
Q: 26 Using the diagram below, describe the changes that occur if a fertilised egg becomes implanted in…
A: A multitude of factors must come together in order for a baby to be born. The development of a human…
Q: Glycophorin, a protein in the plasma membraneof the red blood cell, normally exists as a homodimer…
A: Hydrophobic means water repelling. There are certain amino acids in a protein which poses…
Q: diagram that explains the core concept of flow down gradients in the urinary system/kidneys?
A: Urinary system The urinary system comprises the kidneys, urinary bladder, ureters and urethra. Its…
Q: Match each item with the correct statement below. Nonpharmacologic methods to manage…
A: Introduction :- Both Crohn's disease and ulcerative colitis are inflammatory bowel diseases. Crohn's…
Q: Match the viruses with the diseases that they cause: Human Immunodeficiency virus Herpes zoster H1N1…
A: Viruses are the connecting link between the living and the non living. These have some properties of…
Q: Definition of term renewable resources, nonrenewable resources, sustainable use, endemic,…
A: Q. Definition of term renewable resources, nonrenewable resources, sustainable use, endemic,…
Q: O A) the nitrogenous base and the first phosphate group O B) the ribose sugar and the nitrogenous…
A: INTRODUCTION ATP (adenosine triphosphate) is an energy-carrying molecule found in the cells of…
Q: Root hairs increase the surface area of the root O increase water absorption increase nutrient…
A: Water and mineral nutrients move from the soil to the upper parts of the plants through the xylem.…
Q: The tip of a plant like the prairie species we grew in class, where cells are continuously dividing…
A: Plants undergo primary growth to increase length and secondary growth to increase thickness.Growth…
Q: Strain X. spp. is a rod-shaped, anaerobic, Gram-positive bacterium with peritrichous flagella and…
A: Given information Doubling time 240 minutes = 4 hours. Initial population = 10 cells Final…
Q: QUESTION 1 Picture 1 Pic. 1: Name one genus/species from the fungi we studied that might be growing…
A: Fungi are Eukaryotic organism that can be one cell or many celled . Fungi is classified into :- I…
Q: The current state-of-the-art in forensic DNA profiling involves the PCR-amplification and analysis…
A: PCR is a process in which millions of copies of a specific sequence of DNA can be made in a matter…
Q: The following strand is a template strand: 3'-АТСТАСССТТCGACTAGAАСААСТ-5' The non-template strand is…
A: DNA ( Deoxyribonucleic acid) is ladder like helical structure which act as genetic material in most…
Q: Review the main underlying molecular mechanisms, including molecular pathways and downstream…
A: Alzheimer's disease is a neurodegenerative disease, that usually starts in a slow manner and…
Q: What is STD? in 3 paragraphs (Introduction, Body and Conclusion)
A: Answer
Q: 9. Most species of Clostridium, which are widely distributed in the environment, are harmless to…
A: Infection is the entrance of pathogens into an organism's bodily tissues, their growth, and the host…
Q: To explain: The impact on the phenotype of common wall cress (Arabidopsis thaliana) as a result of a…
A: Mutation is a permanent variation of some nucleotide sequences in an organism's genome that can…
Q: What taxa employs each of these modes of reproduction: 1. Recombinational 2. Primordial 3. Typical…
A: Reproduction: The process of production of new offspring from the parental ones is termed…
Q: Which of the following is an evolutionary leftover from a feature that a common ancestral special…
A: Introduction Evolution:- It is a process of gradual change in the characteristics of a species over…
Q: You are counting white blood cells in a freshly drawn blood sample. You dilute the blood 1/20 in 5%…
A: The answer is option D.8.7×10 power 6.
Q: Why do anisogamous organisms only experience the twofold cost of sex?
A: Anisogamy is a type of sexual reproduction that involves the union or fusion of two gametes that…
Q: Proteus vulgaris is positive for the production of the enzyme phenylalanine whereas Escherichia coli…
A: INTRODUCTION Proteus vulgaris is a Gram-negative, rod-shaped, nitrate-reducing, indole-positive, and…
Q: For fusion of a vesicle with its target membrane tooccur, the membranes have to be brought to within…
A: Proteins are well known to define that they are used as large, complex molecules that perform…
Q: Why do anisogamous organisms only experience the twofold cost of sex?
A: Anisogamy Aniosgamy is a reporduction process in which the different forms or sizes of male and…
Q: 17 Match the number of the label in the diagram below with the appropriate site or structure from…
A: Electron transport chain Also called the ETC is composed of four protein complexes. These protein…
Q: What anatomical evidence has been used to support the idea that australopithecines spent time in the…
A: Evolution of human :-
Q: Which stage of mitosis is shown in the picture? Prophase Telophase Metaphase Anaphase
A: Mitosis is equational division. Meiosis is reductional division.
Q: How are the alleles of a gene different from each other? What is its importance?
A: Alleles are different variants of the same gene that are genetically different . For example, a gene…
Q: Which of the following lists the three steps of translation in their proper sequence? O 1.…
A: Translation is defined as the process of protein synthesis. It takes place in the cytoplasm.
Q: whether they are hypotonic or hypertonic, does it have a correlation to why they are bony or…
A: For better understanding, let's understand by knowing the terms used in the question. Hypertonic…
Q: Describe a hypothesis explaining the mutual relationship between plant roots and mycorrhizae present…
A: Introduction Mycorrhizae take nutrients like phosphorus and magnesium and deliver them to the plant…
Q: On a local scale, why are sowbugs commonly found in some places but not others?
A: Sowbugs and their occurrence in limited environment :-
Q: A patient most likely presents with chronic myeloid leukemia (CML) and you have a fullI blood cell…
A: Chronic myeloid leukemia (CML) is also known as 'chronic myelogenous leukemia', is an uncommon type…
Q: A 43-year-old man is diagnosed with chronic myeloid leukemia (CML) and started on standard imatinib…
A: Man with Chronic myeloid leukemia treated with imatinib therapy :-
Q: Parasitic alveolates that form spores at some stage in their life belong to which group? (a)…
A: * The answer of the question is option D that is apicomplexans. * Parasitic alveolates that form…
Q: Given the following sequence for one strand of a double-strand oligonucleotide: 5’ACCGTAAGGCTTTAG3’…
A: Nucleus is main controller of the cell which carries genetic instructions . It contain Chromosome…
Q: How can the information for specifying an organism be carried in chemical form, and how can the…
A: The ability to store and transmit information is crucial for the survival of any organism. In order…
Q: Sample A has been allowed to breed randomly for many generations. At a particular gene locus, there…
A: Population A is in Hardy-Weinberg Equilibrium. That means the sum of the frequency of two alleles is…
Q: 15. Why is PK > PNa and by about how much?
A: A characteristic pattern of the rapid rise and subsequent drop in voltage or membrane potential…
Q: 6. You perform a high throughput DNA sequencing reaction on chromosome number 1 from a newly…
A: a)Arranging the fragments with overlapping sequences on the fragments ends. 2.GGCTATTTCGCCG 4.…
Q: Trace the paths that water and mineral ions travel as they movefrom soil into a root’s vascular…
A: The underground branching root systems of plants are frequently larger than the aerial component of…
Q: Discuss the salient feature of DENR Administration Order No.142, Series of 1989
A: DENR Administration Order No.142, Series of 1989 was concerned to rationalize various programs…
Q: 160 140 120 100 80 60 40 20 1845 1865 1885 1905 1925 Time (years) (a) Based on the graph, identify…
A: The relationship between the lynx and the snowshoe hare is a classic example of the predator-prey…
Q: Of the circled parts, determine which is/are sclerenchyma cells 3 2
A: Sclerenchyma tissue present in plants.
Q: The following step takes place in the Krebs cycle (actually it's two steps but we will assume it is…
A: Krebs cycle is also known as citric acid cycle or tricarboxylic acid cycle. In prokaryotes, it takes…
Q: Which are with Helper T-cells
A: Helper T-cells is a type of immune cell that stimulates killer T cells, macrophages, and B cells to…
Q: Which of the following best describes the central dogma of molecular biology? O A) MRNA is…
A: Introduction In molecular biology, a central dogma is an illustration showing the flow of genetic…
Trending now
This is a popular solution!
Step by step
Solved in 2 steps
- After a polypeptide chain has been synthesized, certain amino acids in the peptide may become modified. For each modified amino acid, identify the standard amino acid from which it is derived. Enter the unabbreviated name of the standard amino acid. OH I *NH,CH,–C–CH,CH,—CH–COO H C *NH₂ standard amino acid: Identify the modification that yields the first amino acid depicted. addition of a hydroxyl group addition of an amino group modification of the existing amino group modification of the existing hydroxyl group elongation of the side chain by the addition of a -CH₂- groupProvide the 20 amino acids in this format:Identify the 20 amino acids and their corresponding three-letter and one-letter abbreviations
- Identify the correct name or abbreviation for the given nucleoside or nucleotide. guanosine ADP dADP dGDP GDP Identify the correct name or abbreviation for the given nucleoside or nucleotide. GDP dADP ADP O deoxyadenosine dGDP OMP O || -O-P-O-P-O. fot O™ tt -O-P-O- O™ ܘ ܐ ܘ ܐ OIPIO N OH OH OH N H₂N N ΝΗ N NH₂Suggest which part of this sequence belongs to the inner part of the protein and which to the outer shell (use the one-letter code to define amino acid. 1 letter - 1 amino acid): MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEOQWF TEDPGPDEAPRMPEAAPPGVAPTYSAFirst letter U C A UUU UU JUC UUA UUG CUU CUC CUA CUG AUU AUC AUA AUG GUU GUC GUA GUG ] Phenylalanine UCU (Phe) UCC UCA UCG Leucine (Leu) Leucine (Leu) Isoleucine (Ile) Methionine (Met) Valine (Val) CCU CCC CCA CCG b) lysine c) methionine d) tryptophan ACU ACC ACA ACG GCU GCC GCA GCG C Second letter Serine (Ser) Proline (Pro) Threonine (Thr) Alanine (Ala) UAU UAC UAA UAG CAU CAC CAA CAG AAU AAC AAA AAG GAU GAC GAA GAG ] Tyrosine (Tyr) Stop Stop Histidine (His) Glutamine (Gln) Asparagine (Asn) Lysine (Lys) Aspartic acid (Asp) Glutamic acid (Glu) UGU UGC UGA Stop UGG Tryptophan (Trp) CGU CGC CGA CGG AGU AGC AGA AGG GGU GGC GGA GGG ] 1. List the mRNA base codons for the amino acids listed below. 2. a) aspartate: Cysteine (Cys) Serine (Ser) U C Arginine (Arg) A G Arginine (Arg) U C Glycine (Gly) A G U C A G U MCAG А
- Second letter A UUU UCU) UC UCA UCG UAU UUC Phe UUA Tyr UGU UGCJ Ser UAA Stop UGA Stop A UAG Stop UGG Trp UUG Leu CAUHIS CUU CUC CUA CUG CCU* C ССА CCG CGU His САС Leu CGC Arg CGA Pro CAA Gin CGGJ Gln Which amino acid is carried by the TRNA with the anticodon 5'-UCA-3? ACU ACC ACA AAU AAC. AGU AGC AGA AUU Ser Asn AUC Ile A AUA Thr AAA Lys AAG Lys AGG Arg AUG Met ACG GAU GGU] GUU GUC GUA GUGJ GCU GCC GCA GCG GAC Asp Ala GAA GGC Gly GGA Val GAG Glu GGGJ Isoleucine. None-this is a stop codon. Aspartic acid. Histidine. IV. Leucine O V. Third letter UCAG UCAG UCAG First letteridentify the amino acidProvide the correct three-letter abbreviation for the following amino acid: Gln ← H₂N-CH-C-C 1 CH3 Ala Arg Asn Asp Cys Glu Gly His lle Leu Lys 包
- Consider the image of the amino acid. Identify the amino acid. Isoleucine O Glycine Alanine Leucine Identify the three-letter abbreviation for the amino acid. Ile Ala Gly Leu ¹0 + H3N- C -H Н I -HUsing proper convention, provide the amino acid sequence for the following peptide.5'-TAGCTGATCGAATATGCGGTCTCTATCTTCGTAGACGA-3' 3'-ATCGACTAGCTTATACGCCAGAGATAGAAGCATCTGCT -5' Determine the amino acids that will be encoded by this sequence Second letter First letter U C A G U UUU Phe UUC UUA UUG Leu CUU CUC CUA CUG Leu GUU GUC GUA GUG Val UCU UCC UCA UCGJ AUU AUC lle AUA ACA AUG Met ACG CCU CCC C CCA CCG ACU ACC GCU GCC GCA GCG Ser - Pro Thr Ala A UGU UACTyr Cys UGC. UAA Stop UGA Stop A UAG Stop UGG Trp G CAC His CAA Gin CAG GAUT GAC Asp GAA AAU Asn ACC Ser AGU AAG LYS AA Glu GAGJ Oa. N-Met-Arg - Ser-Leu-Ser - Ser-C Ob. N-Met-Pro-Arg - Asn-Asp - Ser-C d. N-Met-Lys - Val-Glu-Ala-C Oc. N-Asp-Pro-Lys - Ser - Val-Ile-C Oe. N- Met-Ala-Asp-Pro-Lys - Ser-C G CGU CGC CGA CGG AGA AGG. GGU GGC GGA GGG Arg SCAO Gly U UCAG UUA DUAG Arg G Third letter 13