a) Bioinformatics is an interdisciplinary field that integrates computer science with mathematics and statistics to solve biological questions. Many bioinformatics tools for gene prediction, homology modelling and such are available free online. How can online tools such as BLAST and FASTA assist in our genomics research? (i) Is the sequence below in FASTA format? Justify your answer. >gi 129295|sp|P01013|OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED) QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE (ii) KMKILELPFASGDLSML VLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP FLFLIKHNPTNTIVYFGRYWSP

a) Bioinformatics is an interdisciplinary field that integrates computer science with mathematics and statistics to solve biological questions. Many bioinformatics tools for gene prediction, homology modelling and such are available free online. How can online tools such as BLAST and FASTA assist in our genomics research? (i) Is the sequence below in FASTA format? Justify your answer. >gi 129295|sp|P01013|OVAX_CHICK GENE X PROTEIN (OVALBUMIN-RELATED) QIKDLLVSSSTDLDTTLVLVNAIYFKGMWKTAFNAEDTREMPFHVTKQESKPVQMMCMNNSFNVATLPAE (ii) KMKILELPFASGDLSML VLLPDEVSDLERIEKTINFEKLTEWTNPNTMEKRRVKVYLPQMKIEEKYNLTS VLMALGMTDLFIPSANLTGISSAESLKISQAVHGAFMELSEDGIEMAGSTGVIEDIKHSPESEQFRADHP FLFLIKHNPTNTIVYFGRYWSP

Human Heredity: Principles and Issues (MindTap Course List)

11th Edition

ISBN:9781305251052

Author:Michael Cummings

Publisher:Michael Cummings

Chapter4: Pedigree Analysis In Human Genetics

Section: Chapter Questions

Problem 4QP: Pedigree Analysis Is a Basic Method in Human Genetic: What does OMIM stand for? What kinds of...

See similar textbooks

Similar questions

Bioinformatics is an interdisciplinary field that integrates knowledge of computer science with mathematics and statistics to solve biological questions. Many bioinformatics tools for gene prediction, homology modelling and such are available free online. (1) What does BLAST stand for? (ii) Explain the function of BLAST.
Hi, I would like to know which program is used for the graphical presentation of the results of a meta-analysis of genome-wide linkage scans?
Describe the main technique for amplifying a segment of DNA (like the one you suspect is involved in Lee’s cancer) from a complex mixture of genomic DNA. Remember that the entire human genome sequence is known. (Hint: This is a technique that is commonly used by laboratories that do genetic testing and various other applications of molecular biology.)
Bioinformatics is an interdisciplinary field that integrates computer science with mathematics and statistics to solve biological questions. Many bioinformatic tools for gene prediction, homology modelling and such are available free online. State the functions of CLUSTAL W, BLAST and GLIDE (Schrödinger).
Transcriptome analysis involves two separate methodologies: gene expression and RNA seq analyses. The 10 items below are a scrambled listing of the steps used in the two procedures. Identify the steps involved in RNA seq from the list below. Use the numbers in the list to refer to each step. Once the steps for RNA seq have been identified, write the steps in the order in which they are performed during the experiment. (1) DNA sequencing (2) Allow for hybridization and wash excess cRNA. (3) Mix labeled cRNA with array chip. (4) PCR amplification (5) Measure fluorescence intensity to determine abundance of transcripts. (6) Add labeled cRNA at each microarray location. (7) Map cDNA sequences to the genome of the organism to determine identity and abundance of transcripts. (8) mRNA isolation from cells (9) Prepare fluorescently labeled cRNA probes (10) cDNA synthesis
From your knowledge about DNA microarray, answer the following: A- How DNA microarray is created? and why it is referred to as “hybridization technology”? B- Why RT-PCR is important in the sample preparation to perform expression microarray experiment? C- Mention the name and the color of the dyes used in expression microarray? D- If the expression microarray experiment was done with a normal sample and a suspected sample, after reading the color pattern resulted from the experiment it was recorded that “gene A22” is expressed in the suspected sample. The gene A22 is clinically linked to colon cancer. Answer the following: What is the expected color of the spot on the microarray which represents this gene? What is your interpretation of the suspected sample; is it a cancer sample or not and explain why?
Pedigree Analysis Is a Basic Method in Human Genetic: What does OMIM stand for? What kinds of information are in this database?
Describe two of the applications for genome mapping.
Let’s suppose you are in charge of organizing and publicizing a databasefor the mouse genome. Make a list of innovative strategies you wouldinitiate to make the mouse genome database useful and effective.
While comparative genomics is fundamentally the study of the differences between the genomes of species, it can also give clues about functional genomics (the study of the biological functions that rely on genomic sequences i.e. related sequences that encode the various proteins within a family). How? Give an example
What provides a convenient bridge between the low resolution of a karyotype and the ultra-high resolution of a complete genomic sequence?
Each of the following describes a distinctive step in a genomic technology or experimental design. Match the name of the technology or experimental design to the description. Answers may be used more than once or not at all. Add fluorescent tags onto the single-stranded sample of nucleic acids before the sample is applied to a glass slide. [ Choose ]When aligned to a reference genome, read depth indicates duplications and deletions. [ Choose ]A spot appears as a mix of two fluorescent colors if the individual is heterozygous. [ Choose ]An experimental design that relies on identifying unrelated individuals that have one of two phenotypes, then looking for a correlation between individual phenotype and genotype. [ Choose ] choices: GWAS, RNA microarray, RNA sequencing, DNA microarray, quantitative genetics, family study, genomic resequencing