Which of the following first messengers is a polypeptide? O acetylcholine adrenaline O insulin Oprogesterone O epinephrine
Q: The net ATP produced during a β-oxidation process is always less than two ATP because An ATP is…
A: Beta oxidation is a catabolic process by which fatty acid molecules are broken down in the…
Q: What is the single definitive test for galactose? State the principle.
A: Galactose is a monosaccharide . it combines with glucose to form a disaccharide called lactose. It…
Q: Using proper convention, provide the amino acid sequence for the following protein. O H₂N-CH- CH₂…
A: Proteins are large molecules made up of amino acid residues linked via a peptide bond. Amino Acids…
Q: single-substrate reaction E+SESE+P.7 nditions: [S] > Km- ent with the condition that it describes.…
A: .
Q: Name three ketone bodies and describe their functions
A: Ketogenesis is a process by which the liver produces ketone bodies from fatty acids, as a source of…
Q: Why is derivatization (i.e., transesterification) of triglycerides or lipids to fatty acid methyl…
A: Triglycerides are fatty acid esters of glycerol, where three fatty acid molecules are linked to one…
Q: Phosphorylation is one of the most common mechanisms for regulating the activity of enzymes that…
A: Enzymes constantly switch between activated and deactivated forms, as per the cell's needs. Covalent…
Q: Which of these is NOT true of nucleosomes? A. Some post-translational modifications to histone…
A: Nucleosome is the basic subunit of chromatin. It is the basic unit of DNA packaging. Nucleosomes…
Q: How many hydrogen bonds exist between this DNA strand and its complementary strand? 5'-GCATAAT-3'
A: Nucleic acids are biomolecules that are essential for all life forms. They are polymers of…
Q: a. What hormone is released in response to increased blood glucose? 2. b. The binding of this…
A: Since you have posted a question with multiple sub parts, we will provide the solution only to the…
Q: The carbon skeletons of many amino acids can be used to replenish the intermediates of the citric…
A: Since you have posted multiple MCQ questions, we will provide the solution only to the first three…
Q: How are intracellular and extracellular proteins degraded?
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: 4. Identify: for nos. 1-5: Name of the missing metabolite in the pathway 6-10: Enzyme that catalyzed…
A: Catabolism is the breakdown of complex substances into simpler molecules, while anabolism is the…
Q: Which of the following statements are true for enzymes? Check all that apply. The activity of some…
A: Enzymes are high molecular weight proteins (exceptions are catalytic RNAs) that catalyse biochemical…
Q: With respect to DNA and RNA polymerases which statement is correct? OA) Only DNA polymerases are DNA…
A: DNA and RNA polymerases are enzymes that work on DNA. DNA polymerase is responsible for DNA…
Q: a) You evaluate the lipoxygenase inhibition by different concentrations of octyl protocathechuate.…
A: Inhibitors are the substances that bind to enzymes to regulate their activity . There are…
Q: OH H Almost 30% of the cocoon of the parasitic beetle Larinus DH maculatus consists of the…
A: Carbohydrates or carbs are macronutrient consisting of Carbon, hydrogen and oxygen atoms. In nature…
Q: Question 14 The first three amino acids in a protein are lysine, glutamine, and serine. T describes…
A: The four classes of biological macromolecules are proteins, nucleic acids, carbohydrates and lipids.…
Q: 4. Describe the role of His in the catalytic mechanism shown.
A: Enzymes are highly specialized proteins that have extraordinary catalytic power, greater than that…
Q: ermination of translation occurs when the ribosome reaches one of _____ potential stop codons. At…
A: Introduction: The process of translation involves messenger RNA (mRNA) getting translated into…
Q: Question 9 Briefly discuss the discovery and development of selective inhibitors of sodium-glucose…
A: Sodium-glucose linked transporters (SGLTs) , or to be more specific Sodium-glucose linked…
Q: describe the extent of conformational flexibility associated with peptide bonds and their…
A: Proteins are large biomolecules made up of amino acid residues linked via a peptide bond. Amino…
Q: Why is de novo biosynthesis of purines markedly elevated in patients with a deficiency in…
A: HGPRT is an important enzyme in the recycling of building blocks of nucleic acids like DNA or RNA.…
Q: Using the following key terms, discuss the regulation of carbohydrate metabolism. Insulin,…
A: Introduction Glycolysis is a process by which glucose converts into pyruvate and ATP is produced.…
Q: Substances like phencyclidine (PCP, or "angel dust") and ketamine ("Special K") are characterized…
A: INTRODUCTION : Phencyclidine : It is a synthetic drug, which is a compound being derived from…
Q: The sequence of a peptide is given below. YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE If you perform peptide…
A: Proteins are composed of amino acids, which are bound together by peptide linkage. Amino acids…
Q: hormone-sensitive lipase that are needed for triacylglycerol mobilization is activated by:…
A: Hormone sensitive lipase are cytosolic proteins. They remain in inactive unphosphorylated form. In…
Q: ATP is a source of free energy that drives unfavorable reactions. Which of the processes are coupled…
A: The free energy changes in chemical reactions are denoted by ΔG. ∆G = ∆H − T∆S where ∆H is the…
Q: 5. Anaerobic glycolysis: definition, localisation, biological significance.
A: All living organisms go through cellular respiration, which begins with glycolysis. In the cytoplasm…
Q: Why is the binding of oxygen to hemoglobin cooperative while the binding of oxygen to myoglobin is…
A: Hemoglobin has 4 subunits, 2 alpha subunits, and 2 beta subunits. These 4 subunits collectively make…
Q: Glycogenesis occurs in both muscle and liver. Select one: O True O False Glycogen is released from…
A: Glycogen is storage-type homopolysaccharide that contain two types of glucose polymers: amylose:…
Q: The table below lists factors that regulate metabolite flow through the pyruvate dehydro- genase…
A: There are a wide variety of metabolic pathways that can take place within a cell. Hence , one…
Q: A sample of yeast extract has been analyzed of its invertase activity. The effect of temperature on…
A: Invertase is the enzyme that catalyze the hydrolysis of sucrose in fructose and glucose. Sucrose is…
Q: 1. Describe the role of Cys in the catalytic mechanism shown. 2. Describe/predict the…
A: Enzymes are highly specialized proteins that have extraordinary catalytic power, greater than that…
Q: 3. Consider the reaction: H3C-(CH₂) H H C—C—C—SCOA HH H3C-(CH₂) a. What kind of reaction is being…
A: The given molecule is a fatty acyl CoA. Fatty acids are highly reduced and provide energy in the…
Q: 4. Blood glucose level, glucose transporter proteins (classification, localisation and biological…
A: Blood Glucose is the major sugar found in our blood.It is the main source of energy used by a cell.…
Q: 60. During a study of thyroid hormone function, an experimental line of mice is genetically…
A: the thyroid gland malfunctions and doesn't produce enough thyroid hormones: thyroxine and…
Q: The primary purpose of the aconitase step in Citric Acid Cycle is to: form the intermediate…
A: The citric acid cycle involves acetyl-CoA oxidation into carbon dioxide and water. The acetyl-CoA…
Q: The study above was done on a wildtype enzyme and three genetically-engineered mutants. The purpose…
A: INTRODUCTION : Wild type Enzyme - These are the enzymes which are found naturally and are not…
Q: What are ketone bodies? How are they formed? What makes carboxylic acids acidic? Define the…
A: ketone bodies act as a source of energy under glucose and fat-deprived conditions. They are secreted…
Q: Question 2 Briefly explain how the antioxidant activities of tocochromanol natural products can be…
A: Tocopherol and tocotrienols are collectively called vitamin E. There are four tocotrienols found in…
Q: The degradation of CH3 (CH₂ )10 - COOH via the beta-oxidation pathway requires: 6FAD + 6NAD+ +…
A: Fatty acids metabolism involves β-oxidation which happens in the mitochondrial matrix. In…
Q: NH4+ is transported indirectly in the body. Why can’t free NH4+ be transported in the blood? How is…
A: NH4+ is the waste product formed from the amino acids on their catabolism. It must be transported…
Q: Define what a substrate cycle is and how it might be beneficial to an organism.
A: Introduction All living organisms need energy for their survival. We take food to get energy. The…
Q: When the movement of lipids in biological membranes was measured, it was observed that: A) Saturated…
A: The cell membrane is a phospholipid bilayer. According to the Fluid Mosaic Model, the cell membrane…
Q: Graph a double reciprocal plot that satisfy the following: a. Michaelis-Menten kinetics enzyme,…
A: For a one-substrate enzyme-catalyzed reaction, the Michaelis-Menton equation shows the quantitative…
Q: Given: Beer-Lambert Law A = Ecl E = 8000 for Met myoglobin E= 14,000 for oxy-myoglobin l=1 cm…
A: According to Beer-Lambert law the concentration of the sample is directly proportional to the…
Q: Which of these is not a reducing sugar
A: Carbohydrates are polyhydroxy aldehydes or ketones. They can be classified as monosaccharides,…
Q: Perform a pyruvate dehydrogenase reaction and a single turn of the citric acid cycle using an…
A: Oxidation of carbohydrate (Glucose) provides energy in the form of ATP. The complete oxidation of…
Q: In 1958, Meselson and Stahl conducted an experiment to determine which of the three proposed methods…
A: Three important experiments contributed to our current understanding of DNA structure and function:…
Step by step
Solved in 2 steps
- Which of the following first messengers is hydrophobic and binds to a nuclear receptor protein inside cells? Oglucagon epinephrine O acetylcholine Oglucocorticoid insulinIdentify the structure highlighted in green: Epinephrine receptor ACh receptor Norepinephrine receptorWhich of these neurotransmitters is an endocannabinoid? ts O glutamate O adenosine O serotonin all are endocannabinoids none are endocannabinoids
- Which of the following substances acts as a neurotransmitter? catechol O norepinephrine O dopamine more than one response is correctSteroid hormones are derivatives of: cholesterol O polypeptides O tryptophan O tyrosineA 67-year old man has been treated for prostate cancer. He is receiving a drug that blocks testosterone from binding to its intracellular receptor. Which of the following has this mechanism of action: Tamoxifen Flutamide Leuprolide Fulvestrant Interleukin-2
- The rate limiting enzymes for norepinephrine is respectively. Aromatic catecholaminase; serotonin methylase tyrosine carboxylase; tryptophan carboxylase amino acid decarboxylase; tyrosine decarboxylase tyrosine hydroxylase; tryptophan hydroxylase and for 5-HT isWhich of the following can be synthesized from phenylalanine? Epinephrine Melatonin y-amino butyric acid serotonin spermidineWhich of the following is false? Steroids do not require a G protein and second messenger. The average pH of blood is 7.4 Increased levels of AMP will cause an increase in enzyme activity A G protein links the first messenger with the second messenger.
- Endocrine Ligand acting on intracellular receptor should be: O Hydrophilic O Hydrophobic O Amphipathic O Macromolecule What kinds of molecules may pass throughA patient has a tumour of the chromaffin cells in the adrenal medulla. Whilst awaiting surgery, he is treated with an antagonist which reduces the consequences of adrenal medulla overactivity by binding alpha adrenergic receptors irreversibly. Which one of the following drugs has he been treated with? Answers A - E A Clopidogrel B Lansoprazole C Aspirin Propranolol E PhenoxybenzamineWhich of the following is/are not stimulated by cAMP? Phosphofructokinase Epinephrine Muscle phosphorylase Protein kinase A Brain phosphorylase