f a commercially available insulin preparation contains 1 ppm of proinsulin, how many micrograms of proinsulin would be contained in a 10-mL vial of insulin?

Q: CYP2E1 has a much higher Km for ethanol than ADH (11 mM versus 0.05 mM, respectively). When greater…

A: km that is Michaelis Menten's constant is a substrate concentration of the enzyme catalysed reaction…

Q: Based on intermolecular attractions, why is honey, which is made up of carbohydrates, 2,000 times…

A: A fluid's viscosity is a measurement of its resistance to deformation at a certain rate. As a…

Q: Explain using 2-3 sentences the biological significance of the following peptides .   Glucagon…

A: Peptides are short chains of amino acids linked by peptide bonds. Peptides are smaller than…

Q: Which of the following correctly does not correctly describe the composition of a…

A: Given are some components of phosphatidylethanolamine following among does not correctly describe…

Q: During intensive muscle work there is a large amount of ammonia produced in the muscles. What amino…

A: Gluconeogenesis can be defined as a metabolic pathway that produces glucose using precursors that…

Q: Human insulin protein MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG…

A: The polymerase chain reaction is a molecular technique responsible for exponentially amplifying a…

Q: Three amino acids that donate amine groups for the purine biosynthesis are a) Glycine, glutamine,…

A: Purines are heterocyclic aromatic compound of carbon and nitrogen and forms nucleotides that in turn…

Q: Which of the following is the Haworth Projection of Glucose?

A: The cyclic structure in Haworth projection displays the ring as flat. In the associated Haworth…

Q: Define the term Allosteric Modulation?

A: The word, Allosteric, is derived from the Greek language in which Allos meaning 'other' and stereos…

Q: What is role of insulin in human body?

A: Introduction Glucose is the main source of energy and the simplest carbohydrate which is present in…

Q: What is the effect on lipid profile in case of diabetes mellitus ?

A: Insulin plays a major role in controlling fat metabolism . Therefore both type 1 and type 2 diabetes…

Q: HbA1c is used to monitor blood glucose levels because hemoglobin is the only protein in blood that…

A: “Since you have asked multiple question, we will solve the first question for you. If youwant any…

Q: Which of the following is false about chymotrypsin? A   Hydrolytic cleavage of a peptide bond by…

A: BASIC INFORMATION ENZYMES They are the catalyst. They help in accelerating the chemical reaction.…

Q: Name the genetically engineered human Insulin?

A: The process of artificial modification, manipulation, and recombination of DNA or other nucleic acid…

Q: What are the possible sources of errors or deviations between the theoretical and experimental pKa…

A: pKa value: pKa or Acid dissociation constant is also known as acidity constant or acid-ionization…

Q: Why are nerve cells particularly sensitive to changes in bloodglucose concentration?

A: Ans: The glucose is transported to different parts of the body by diverse mechanisms or by receptors…

Q: How does the amino acid substitution and amino acid chain in protamine zinc insulin help control the…

A: Biotechnology is the use of our understanding of biological processes to develop useful applications…

Q: What is the raw material used for human insulin produced using E.coli? What is the stoichiometric…

A: The hormone is the chemical messenger found in living things. It is directly poured into the blood…

Q: What would be the result of a substitution of TA for the GC at position 10?

A:

Q: Iodine-131 is commonly used for the treatment of Graves' disease, which is a disease of the thyroid…

A: Grave disease --It is an autoimmune condition  where immune system of body affect the thyroid gland…

Q: Among all the endocrine glands one particular gland is more susceptible towards abnormal function -…

A: There are many types of endocrine signaling in the body, which plays different functions in…

Q: Which of the following cause and effect relationships below is incorrect?      higher ligand…

A: A potential gradient known as membrane potential causes ions to passively migrate in one direction:…

Q: What peptides are expected to be produced when the A chain of bovine insulin (Figure 5.16) is…

A: Protein is a polymer of amino acids connected together via peptide bond. It may have one or multiple…

Q: 1) Draw a chromatogram depicting separation of proteins 1, 2, and 3 (protein #1, mw 30,000, protein…

A: The diagram of chromatograph  is as follows-

Q: A mutant form of polypeptide hormone angiotensin II has the amino acid composition (Asp, Arg, Ile,…

A: Introduction: The amino acids are combined by an amide or peptide bonds. The series of amino acids…

Q: If an amino acid weighs 100 Da, and the protein contains 70 amino acids, what is the weight of the…

A: Amino acids are the building blocks of proteins. Multiple amino acid units are joined together to…

Q: (a) What are the main differences between glucogenic and ketogenic amino acids? (b) Why do would…

A: a)ANSWER;- The principal distinction between glucogenic amino acids and ketogenic amino acids is…

Q: The anabolic steroid methandrostenolone is shown here. (a) How does it diff er structurally from…

A: Anabolic-androgenic steroids (AASs) are drugs derived from testosterone molecule modification to…

Q: What would be the effect of adequate concentration of AMP andGMP?

A: AMP: Adenosine Monophosphate GMP: Guanosine Monophosphate

Q: In preparation for the winter months, a squirrel gorges itself daily with 25g of blueberries (100 g…

A: Fructose can be converted to glucose and then converted to acetyl CoA 3.6 gm of fructose will get…

Q: Insulin possesses two polypeptide chains denoted A and B that are linked by disulfide bonds. Upon…

A: Insulin is composed of two subunits named as A and B. These subunits are attached with each other…

Q: Suppose that the half-life of steroids taken by an athlete is 42 days. Assuming that the steroids…

A: Half-lives for steroids (or any other biomolecule) are defined as the amount of time required to…

Q: Consider the following blood group A, B, AB and O.What are the sugar(carbohydrate ) content of their…

A: Blood type refers to the classification of blood based on the presence and absence of certain…

Q: hat are the physiological effects of prostaglandins, explain how aspirin can block the synthesis of…

A: Introduction: Prostaglandins are a group of closely related biologically active lipids, that are…

Q: What is an example of a biomolecule that interacts with Insulin? Please give a detailed explanation…

A: Hormones are chemical messengers that transmit instructions from one cell to another. They are the…

Q: The affinity of hemagglutinin for sialic acid is quite low, with a Kd of approximately 5 mM. How…

A: Sialic acid is found in cell surface receptors of the host cells and it can be either a ganglioside…

Q: What are MTPs ? Under what conditions MTPs are legally permitted?

A: Reproduction is not always successful and some genetic and/or epigenetic factors produce one or more…

Q: Can a pregnant cocker spaniel (dog) synthesize prostaglandin E2 from the dietary glucose? Yes or No.…

A: Prostaglandin E2 is considered a hormone, which plays a key role to induce labor during pregnancy.…

Q: Draw and name the most prevalent anomeric form of glucose present in physiological systems?

A: Macromolecules are types of biomolecules that are needed in large amounts for the growth and…

Q: c) Jean-François is studying a specific protein in a research laboratory. he observed that this…

A: Proteins are very senstive to the change in pH as they are functional at a narrow pH range. The…

Q: Write a balanced equation for the synthesis of phosphatidylethanolamine by the de novo pathway,…

A: Phospholipids are a class of lipids that consist of two fatty acyl molecules which are esterified at…

Q: Please calculate the ΔG of glucose transport into the cell if the concentration of glucose is 1mM…

A: ΔG = R T  ln ([glucose]in)/([glucose]out) Concentration of glucose inside = 1mM   Concentration of…

Q: The followings are the biological roles of cholesterol EXCEPT ____.   a. as a component of…

A: Cholesterol is a lipid, it plays a major role in cellular function.it acts as a precursor for the…

Q: By what the two polypeptides of human insulin are linked together?

A: Insulin is peptide hormone secreted by pancreatic cells that is responsible for reduction of blood…

Q: What are four Rs

A: The four Rs are required to be eco friendly.  For living a sustainable lifestyle, we can use these…

Q: Novolog differs from "normal" insulin in that: Select one: a. An aspartic acid has been substituted…

A: Novolog is an artificial insulin analog, which has made structurally and functionally similar so…

Metabolic pathways

Metabolism is defined as the group of life-supporting, enzyme-mediated chemical reactions in organisms. A metabolic pathway is a set of these chemical reactions that involve anabolism (synthesis of complex biomolecules) and catabolism (breakdown of biomolecules into small molecules) that occur inside a cell. Metabolites are the reacting substances, products, and intermediate substances of an enzymatic process that are altered by a series of chemical events catalyzed by enzymes.